На головну

 Спадкування груп крові резус - Біологія і хімія

На малюнку представлено положення резус білка резус в мембрані еритроцитів.

Чому він так названий? У 30-40-х роках, коли досить інтенсивно проводилися дослідження груп крові, було виявлено, що антитіла до групи крові мавпи резус агглютинируют у деяких людей їх еритроцити.

Аглютинація - це процес склеювання еритроцитів під дією антитіл до Белам, розташованим на мембранах еритроцитів. На малюнку нижче представлений картина аглютинації. Тут зображені крапельки крові, до яких додана сироватка, яка містить антитіла до резус-білку. Синім обведені краплі, в яких з кров'ю нічого не відбувається. Якщо реакція при додаванні антитіл не йде, то, значить у даної людини резус-білок відсутній. Червоним обведені зразки крові, в яких відбувається аглютинація. Літерами позначені краплі крові, які реакцію дають, але дуже слабку. Таке зустрічається у приблизно 1% людей, і це так і званий слабкий резус фенотип.

З чим це пов'язано? На малюнку нижче літерами представлена ??послідовність резус-білка. Ви знаєте, що білок складається з 20 амінокислот, кожна з яких позначається своєї буквою. Ген (послідовність нуклеотидів, відповідно, в 3 рази довша послідовність, записана тільки четиремя буквами, а не 20), який кодує резус-білок, називається RHD.

Амінокислотноїпослідовності РЕЗУС-БІЛКА ЛЮДИНИ

(Кожна амінокислота позначена однією буквою):

Інформація з бази даних NCBI

Human RhD blood group antigen mRNA, complete cds

ORGANISM Homo sapiens

standard_name = "RhD"

MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQV

GQDLTVMAAIGLGFLTSSFRRHSWSSVAFNLFMLALGVQWAILLDGFLSQ

FP SGKVVITLFSIRLATMSALSVLISVDAVLGKVNLAQLVVMVLVEVTA

LGNLRMVISNIFNTDYHMNMMHIYVFAAYFGLSVAWCLPKPLPEGTEDKD

QTATIPSLSAMLGALFLWMFWPSFNSALLRSPIERKNAVFNTYYAVAVSV

VTAISGSSLAHPQGKISKTYVHSAVLAGGVAVGTSCHLIPSPWLAMVLGL

VAGLISVGGAKYLPGCCNRVLGIPHSSIMGYNFSLLGLLGEIIYIVLLVL

DTVGAGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHEA

KYFDDQVFWKFPHLAVGF

Послідовності нуклеотидів кодує частини ГЕНА РЕЗУС-БІЛКА ЛЮДИНИ

Інформація з бази даних NCBI

 1 atgagctcta agtacccgcg gtctgtccgg cgctgcctgc ccctctgggc cctaacactg

 61 gaagcagctc tcattctcct cttctatttt tttacccact atgacgcttc cttagaggat

 121 caaaaggggc tcgtggcatc ctatcaagtt ggccaagatc tgaccgtgat ggcggccatt

 181 ggcttgggct tcctcacctc gagtttccgg agacacagct ggagcagtgt ggccttcaac

 241 ctcttcatgc tggcgcttgg tgtgcagtgg gcaatcctgc tggacggctt cctgagccag

 301 ttcccttctg ggaaggtggt catcacactg ttcagtattc ggctggccac catgagtgct

 361 ttgtcggtgc tgatctcagt ggatgctgtc ttggggaagg tcaacttggc gcagttggtg

 421 gtgatggtgc tggtggaggt gacagcttta ggcaacctga ggatggtcat cagtaatatc

 481 ttcaacacag actaccacat gaacatgatg cacatctacg tgttcgcagc ctattttggg

 541 ctgtctgtgg cctggtgcct gccaaagcct ctacccgagg gaacggagga taaagatcag

 601 acagcaacga tacccagttt gtctgccatg ctgggcgccc tcttcttgtg gatgttctgg

 661 ccaagtttca actctgctct gctgagaagt ccaatcgaaa ggaagaatgc cgtgttcaac

 721 acctactatg ctgtagcagt cagcgtggtg acagccatct cagggtcatc cttggctcac

 781 ccccaaggga agatcagcaa gacttatgtg cacagtgcgg tgttggcagg aggcgtggct

 841 gtgggtacct cgtgtcacct gatcccttct ccgtggcttg ccatggtgct gggtcttgtg

 901 gctgggctga tctccgtcgg gggagccaag tacctgccgg ggtgttgtaa ccgagtgctg

 961 gggattcccc acagctccat catgggctac aacttcagct tgctgggtct gcttggagag

 1021 atcatctaca ttgtgttgct ggtgcttgat accgtcggag ccggcaatgg catgattggc

 1081 ttccaggtcc tcctcagcat tggggaactc agcttggcca tcgtgatagc tctcacgtct

 1141 ggtctcctga caggtttgct cctaaatctt aaaatatgga aagcacctca tgaggctaaa

 1201 tattttgatg accaagtttt ctggaagttt cctcatttgg ctgttggatt ttaagcaaaa

 1261 gcatccaaga aaaacaaggc ctgttcaaaa acaagacaac ttcctctcac tgttgcctgc

 1321 atttgtacgt gagaaacgct catgacagca aagt //

У більшості людей (85%) є ген резус-фактора, але у 15% цей ген відсутній, відсутній відповідний гену нуклеотідний "текст". Якщо цей ген присутній, то він визначає у людини синтез резус-білка. Якщо ж його немає, то резус-білок не синтезується.

Такі різні "стану" гена - варіації нуклеотидного "тексту" називаються альтернативними формами або коротко -аллелямі. В даному випадку варіація - це наявність або відсутність всієї нуклеотидної послідовності гена.

У людини може зустрічатися 3 варіанти поєднання резус-алелей. Людина, у якої 2 алелі з присутніх геном, має групу крові резус позитивну (рис. 4 вгорі). Якщо у людини на одній з хромосом ген відсутній, то білок все одно синтезується з гена на інший хромосомі; і резус-група також позитивна (рис. в середині). Білок не синтезується тільки в тому випадку, коли ген відсутній на обох хромосомах. Тільки в цьому випадку група крові резус-негативна (рис. 4 внизу).

Питання, яке було задане, описував ситуацію, коли обоє батьків мають два різних аллеля. Тобто обидва вони резус-позитивні, але другий аллель у них не містить послідовність, що кодує резус-білок. І обидва їх дитини отримали від кожного з батьків якраз цей аллель з відсутнім геном. Нескладно розрахувати ймовірність народження в такій сім'ї дитини з негативним резус-фактором. Вона дорівнює 25% (1/2 * 1/2 = 1/4); ймовірність ж народження обох дітей з резус-негативної групою крові - 1/16.

Варто згадати про резус-конфлікті. Його суть полягає в наступному. Якщо мати резус-негативна, її чоловік резус-позитивний, і дитина успадковує від батька Rh +, то в крові матері можуть почати вироблятися антитіла проти резус-фактора плоду. При першій вагітності цього зазвичай не відбувається, але при пологах можливий контакт з білками крові дитини, і у матері можуть з'явитися в крові антитіла до резус-фактору. Тоді при наступній вагітності резус-позитивним плодом материнські антитіла зруйнують еритроцити дитини. Це захворювання називається гемолітична жовтяниця (дитина народжується весь жовтий і зазвичай незабаром вмирає). Описано це захворювання вперше в 1609 році французькою акушеркою. Коли була розроблена процедура переливання крові, то таких дітей навчилися рятувати. Їм робили штучне переливання крові, тобто повністю зливали всю їхню кров, і вводили нову. Тепер, коли встановлені причини резус-конфлікту, поступають таким чином. Якщо під час вагітності, у жінки кров резус-негативна, а у чоловіка резус-позитивна, стежать за рівнем антитіл до резус-фактору і проводять необхідне лікування, якщо титр цих антитіл починає зростати. Варто відзначити, що якщо мати резус-позитивна, а сама дитина резус-негативний, то конфлікту не відбувається.

Я б хотіла відзначити один з отриманих відповідей на це питання. Коли ми складали питання для лекцій, ми отримали реальний питання з газети «АиФ» з проханням роз'яснити, в чому справа. Ми вирішили включити це питання до опитувальник, з метою перевірити, наскільки наші слухачі знайомі з генетикою. Власне, питання передбачався як чисто навчальний. І ось одна з відповідей був наступним: «Я б не ризикнув відповідати на це питання, так як я не фахівець, а від моєї відповіді залежить сімейне щастя людини». Хочеться висловити повагу людині, яка так відповів на питання, тому що він сприйняв контекст, в якому стояла чисто навчальне завдання. Він продемонстрував розуміння етичних аспектів, пов'язаних з наукою. Я думаю, ви розумієте, що існує відповідальність вченого, і чудово, що у вашій аудиторії є люди, які вже зараз настільки ясно розуміють зв'язок науки з реальною жиз

© 8ref.com - українські реферати
8ref.com